PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0132s0240.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SRS
Protein Properties Length: 371aa    MW: 41300.3 Da    PI: 7.9759
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0132s0240.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70225.73.3e-083974540
                  DUF702  5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvk 40
                            + +C +CGn a+  C ++ C+ CC      C+ hv 
  SapurV1A.0132s0240.1.p 39 KPKCIQCGNVARSRCPYQSCKSCCSRAQNPCHIHVL 74
                            568*********************99999*****94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.5E-54176IPR007818Protein of unknown function DUF702
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MAASSPVISN NSSDTGQIAI SAAAASFSAP PKSLRGLNKP KCIQCGNVAR SRCPYQSCKS  60
CCSRAQNPCH IHVLKANATF PDKTPASSAP LFEQQPNESP PAVSSHRTAS LRQLSSNFSQ  120
FNNLLSPLRS RKSLTRKEAA AINEWRSSRL KEFRDRNIEV ENEGFDRYMH NISLLEEVLS  180
LKSFLEGSTE DGSLLSNHDH ASAEDDTEEK MVSEQKLKLL SNPRRSENVR KRIQQIVDGG  240
LKKLQKLELN EPDKRAERAK GSRAERASAL SDLAGKLNKA HNEEDLNSCM EIKAQLSSQH  300
TRSRTETKDV DEVLKEQIDK NDLVPPKELD YLSQKLFRTV EIDHETTLTS IDAHFSSLEK  360
IEDLRCGQVF *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002304141.20.0hypothetical protein POPTR_0003s03420g
TrEMBLB9MTW40.0B9MTW4_POPTR; Uncharacterized protein
STRINGPOPTR_0003s03420.11e-179(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF76901618
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32730.14e-87